Base Peps

CBS Product #SMO5

$50.00

  • The CBS Product #SMO5 is designed to meet rigorous standards of quality and performance, ensuring reliability and efficiency for diverse applications. Its innovative features position it as a leading solution in its category.

18 in stock (can be backordered)

10-vial kit 20% OFF
$500.00 $400.00 per kit

Need more? Buy 2+ kits at 30% off on the wholesale shop. See wholesale →

All products are sold for laboratory research use only. Not for human or animal consumption. You must be 18+ to purchase. By ordering you agree to our Terms.
Category:
  • ≥99% HPLC verified Independent third-party testing
  • COA included Certificate of analysis on every batch
  • Ships from the US 2–3 day express delivery

Description

Sermorelin Acetate 5mg – High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

  • Product Name: Sermorelin Acetate 5mg
  • Catalogue Number: UKSERM2
  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3358.9 g/mol
  • Purity: ≥98%
  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
  • Form: Lyophilised Solid

Usage and Storage:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.

Additional information

Vial Pricing

10-vial kit pricing, Per vial pricing