Description
LL-37 5mg – High-Quality Research Peptide
LL-37, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in immunology and microbiology. This product is ideal for laboratory settings where precision and reliability are paramount.
- Product Name: LL-37 5mg
- Catalogue Number: LL37-5mg
- Molecular Formula: C205H340N60O53
- Molecular Weight: 4493.3 g/mol
- Purity: ≥98%
- Sequence: [LL-37, 37 aa]
- Form: Lyophilised Solid
Usage and Storage:
LL-37 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website’s detailed reconstitution and storage guidelines.
